UGT1A6 anticorps (C-Term)

N° du produit ABIN636119

L’anticorps Lapin Polyclonal anti-UGT1A6 a été validé pour WB. Il convient pour détecter UGT1A6 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UGT1A6 anticorps (C-Term) (ABIN636119)

Antigène: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGT1A6 anticorps

Épitope: C-Term

Specificité: UGT1 A6 antibody was raised against the C terminal of µgT1 6

Purification: Affinity purified

Immunogène: UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A6 Blocking Peptide, (ABIN936810), is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A6

Antigène: UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))

Autre désignation: UGT1A6

Sujet: UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha