UGT1A6 anticorps (C-Term)
-
- Antigène Voir toutes UGT1A6 Anticorps
- UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp UGT1A6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- UGT1 A6 antibody was raised against the C terminal of µgT1 6
- Purification
- Affinity purified
- Immunogène
- UGT1 A6 antibody was raised using the C terminal of µgT1 6 corresponding to a region with amino acids APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK
- Top Product
- Discover our top product UGT1A6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
UGT1A6 Blocking Peptide, catalog no. 33R-1424, is also available for use as a blocking control in assays to test for specificity of this µgT1A6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- UGT1A6 (UDP Glucuronosyltransferase 1 Family, Polypeptide A6 (UGT1A6))
- Autre désignation
- UGT1A6 (UGT1A6 Produits)
- Sujet
- UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases.
- Poids moléculaire
- 58 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha
-