NFIA anticorps (Middle Region)

N° du produit ABIN6719349

Détail du produit anti-NFIA anticorps

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Épitope: AA 180-224, Middle Region

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp NFIA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Fonction: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Séquence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SGVFS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for NFIA detection. Tested with Tested with WB, IHC-P, FCM in Human.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Clone: 16H11

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur NFIA

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Autre désignation: NFIA (NFIA Produits)

Synonymes: anticorps NFIA, anticorps CTF, anticorps NF-I/A, anticorps NF1-A, anticorps NFI-A, anticorps NFI-L, anticorps si:ch211-88d2.2, anticorps wu:fq27e07, anticorps zgc:158351, anticorps CNFI-A, anticorps cNFI-A3, anticorps 1110047K16Rik, anticorps 9430022M17Rik, anticorps NF1A, anticorps nuclear factor I A, anticorps nuclear factor I/A, anticorps NFIA, anticorps nfia, anticorps Nfia

Sujet:

Synonyms: Nuclear factor 1 A-type, NF1-A, Nuclear factor 1/A, CCAAT-box-binding transcription factor, CTF, Nuclear factor I/A, NF-I/A, NFI-A, TGGCA-binding protein, NFIA, KIAA1439

Background: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

ID gène: 4774

UniProt: Q12857