PCDH15 anticorps

N° du produit ABIN6719362

Détail du produit anti-PCDH15 anticorps

Antigène: PCDH15 (Protocadherin-15 (PCDH15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDH15 est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro))

Fonction: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Séquence: DLTVYAIDPQ TNRAIDRNEL FKFLDGKLLD INKDFQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for PCDH15 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence of human PCDH15(DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ).

Isotype: IgG

Information d'application

Indications d'application:

Application details: Western blot|0.1-0.5 μg/mL Immunohistochemistry(Paraffin-embedded Section)|0.5-1 μg/mL Immunohistochemistry(Frozen Section)|0.5-1 μg/mL Immunocytochemistry|0.5-1 μg/mL Flow Cytometry|1-3 μg/1x106 cells

Commentaires:

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PCDH15

Antigène: PCDH15 (Protocadherin-15 (PCDH15))

Autre désignation: PCDH15 (PCDH15 Produits)

Synonymes: anticorps CDHR15, anticorps DFNB23, anticorps USH1F, anticorps BB078305, anticorps ENSMUSG00000046980, anticorps Gm9815, anticorps Ush1f, anticorps av, anticorps nmf19, anticorps protocadherin-15, anticorps protocadherin related 15, anticorps protocadherin-15, anticorps protocadherin 15, anticorps PCDH15, anticorps CpipJ_CPIJ005081, anticorps Pcdh15

Sujet:

Synonyms: Protocadherin-15, PCDH15, USH1F

Background: Protocadherin-15 is a protein that in humans is encoded by the PCDH15 gene. This gene is mapped to 10q21.1. This gene is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene result in hearing loss and Usher Syndrome Type IF (USH1F). Extensive alternative splicing resulting in multiple isoforms has been observed in the mouse ortholog. Similar alternatively spliced transcripts are inferred to occur in human, and additional variants are likely to occur.

ID gène: 65217

Pathways: Sensory Perception of Sound