ENO2/NSE anticorps (AA 2-285)

N° du produit ABIN7427918

Cet anticorps anti-ENO2/NSE est un anticorps Souris Monoclonal détectant ENO2/NSE dans WB, IHC, IP et ICC. Adapté pour Humain.

Aperçu rapide pour ENO2/NSE anticorps (AA 2-285) (ABIN7427918)

Antigène: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ENO2/NSE est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Clone: C10

Détail du produit anti-ENO2/NSE anticorps

Épitope: AA 2-285

Fonction: Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Specificité: The antibody is a mouse monoclonal antibody raised against NSE. It has been selected for its ability to recognize NSE in immunohistochemical staining and western blotting.

Réactivité croisée: Souris, Rat

Purification: Protein A + Protein G affinity chromatography

Immunogène: Recombinant Enolase, Neuron Specific (NSE) corresdonding to Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT with N-terminal His Tag

Isotype: IgG2b kappa

Information d'application

Indications d'application: Western blotting: 0.5-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 24 months

Détails sur ENO2/NSE

Antigène: ENO2/NSE (ENO2) (Enolase 2 (Gamma, Neuronal) (ENO2))

Autre désignation: Enolase, Neuron Specific

Sujet: ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase

UniProt: P09104