CD68 anticorps (AA 27-282)

N° du produit ABIN7442816

Cet anticorps anti-CD68 est un anticorps Lapin Polyclonal détectant CD68 dans IHC, WB, IP et ICC. Adapté pour Souris.

Aperçu rapide pour CD68 anticorps (AA 27-282) (ABIN7442816)

Antigène: CD68 (CD68 Molecule (CD68))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD68 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Détail du produit anti-CD68 anticorps

Épitope: AA 27-282

Fonction: Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1)

Specificité: The antibody is a rabbit polyclonal antibody raised against SCARD1. It has been selected for its ability to recognize SCARD1 in immunohistochemical staining and western blotting.

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogène: Recombinant Scavenger Receptor Class D Member 1 (SCARD1) corresdonding to Ala27~Pro282 plus TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA with N-terminal His and GST Tag

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 0.01-2 μg/mL,Immunohistochemistry: 5-20 μg/mL,Immunocytochemistry: 5-20 μg/mL,Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: PBS, pH 7.4, containing 0.02 % Sodium azide, 50 % glycerol.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 24 months

Détails sur CD68

Antigène: CD68 (CD68 Molecule (CD68))

Autre désignation: SCARD1

Sujet: CD68, GP110, Macrosialin, Macrophage Antigen CD68

UniProt: P31996