GRIA2 anticorps (AA 834-883)

N° du produit ABIN7595946

L’anticorps Souris Monoclonal anti-GRIA2 a été validé pour WB, IHC, IP, ICC et IEM. Il convient pour détecter GRIA2 dans des échantillons de Rat.

Aperçu rapide pour GRIA2 anticorps (AA 834-883) (ABIN7595946)

Antigène: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Reactivité: Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp GRIA2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC), Immunoelectron Microscopy (IEM)

Clone: L21-32

Détail du produit anti-GRIA2 anticorps

Épitope: AA 834-883

Fonction: Anti-GluA2/GluR2 Glutamate Receptor Antibody

Specificité: No off-targets reported for GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)

Réactivité croisée: Humain, Souris, Rat

Attributs du produit:

Description: Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB.

Manufacturer Comment: We produce our GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from hybridoma clone L21/32. It is great in EM, IHC, ICC, IP, WB and is purified by Protein A chromatography.

Purification: Produced by in vitro bioreactor culture of hybridoma line followed by Protein A affinity chromatography.

Pureté: > 90 % specific antibody

Immunogène: Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli

Isotype: IgG1

Information d'application

Indications d'application:

Dilution Range: IHC: 1:250

Dilution Range: ICC: 1:500

Dilution Range: WB: 1:500

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 1 mg/mL

Buffer: 10 mM Tris, 50 mM Sodium Chloride, 0.065 % Sodium Azide pH 7.4

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: Aliquot and store at ≤ -20°C for long term storage. For short term storage, store at 2-8°C. For maximum recovery of product, centrifuge the vial prior to removing the cap.

Date de péremption: 24 months

Détails sur GRIA2

Antigène: GRIA2 (Glutamate Receptor, Ionotropic, AMPA 2 (GRIA2))

Autre désignation: GluR2 glutamate receptor

Sujet:

Synonyms: Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)

Target Description: Glutelin type-A 2 (GluA2) , also called GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2 or glutamate ionotropic receptor AMPA type subunit 2, is a member of the Glutamate receptor family of the mammalian brain. This neurotransmiter receptor subunit, which is activated during normal central nervous system fuction, is encoded by the GRIA2 (or GLUR2) gene. GluA2 constitutes a key subunit that regulates AMPA receptors. AMPA receptors lacking of Glua2 have been shown to be present in diseased brains, whose basic fuctions have been altered.

Gene Name Alternatives: Gria2 Glur2

Poids moléculaire: 90 kDa

Pathways: Signalisation PI3K-Akt