RAGE anticorps (AA 91-120)

N° du produit ABIN7877133

L’anticorps anti-RAGE Monoclonal Souris est utilisé pour la détection de RAGE dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, FACS et IHC (p).

Aperçu rapide pour RAGE anticorps (AA 91-120) (ABIN7877133)

Antigène: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp RAGE est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 5C6C1

Détail du produit anti-RAGE anticorps

Épitope: AA 91-120

Fonction: AGER Antibody / RAGE

Séquence: IQDEGIFRCQ AMNRNGKETK SNYRVRVYQI

Purification: Antigen affinity purified

Immunogène: Amino acids 91-120 (IQDEGIFRCQAMNRNGKETKSNYRVRVYQI) from the human protein were used as the immunogen for the AGER antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the AGER antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the AGER antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur RAGE

Antigène: RAGE (AGER) (Advanced Glycosylation End Product-Specific Receptor (AGER))

Autre désignation: AGER

Sujet: The receptor for advanced glycation end products (RAGE) is a multi-ligand member of the immunoglobulin superfamily of cell surface molecules. It interacts with distinct molecules implicated in homeostasis, development and inflammation, and certain diseases such as diabetes and Alzheimer's disease. RAGE is also a central cell surface receptor for amphoterin and EN-RAGE. And RAGE is associated with sustained NF-kappaB activation in the diabetic microenvironment and has a central role in sensory neuronal dysfunction. Moreover, RAGE propagates cellular dysfunction in several inflammatory disorders and diabetes, and it also functions as an endothelial adhesion receptor promoting leukocyte recruitment.

UniProt: Q15109

Pathways: Carbohydrate Homeostasis, Toll-Like Receptors Cascades, Smooth Muscle Cell Migration, S100 Proteins