POR anticorps (C-Term)

N° du produit ABIN7877442

L’anticorps anti-POR Monoclonal Souris est utilisé pour la détection de POR dans des échantillons de Humain. Il a été validé pour WB, FACS et IHC (p).

Aperçu rapide pour POR anticorps (C-Term) (ABIN7877442)

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp POR est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 7F5

Détail du produit anti-POR anticorps

Épitope: C-Term

Fonction: Cytochrome P450 Reductase Antibody / POR / CYPOR

Séquence: RNMARDVQNT FYDIVAELGA MEHAQAVDYI KKLMTK

Purification: Antigen affinity purified

Immunogène: C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur POR

Antigène: POR (P450 (Cytochrome) Oxidoreductase (POR))

Autre désignation: Cytochrome P450 Reductase

Sujet: POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

UniProt: P16435

Pathways: Regulation of Hormone Metabolic Process, Regulation of Hormone Biosynthetic Process, SARS-CoV-2 Protein Interactome