SOD2 anticorps (C-Term)

N° du produit ABIN7877480

Cet anticorps Souris Monoclonal détecte spécifiquement SOD2 dans WB et IHC (p). Il présente une réactivité avec des échantillons de Humain et Souris.

Aperçu rapide pour SOD2 anticorps (C-Term) (ABIN7877480)

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Reactivité: Humain, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp SOD2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 2B12B1

Détail du produit anti-SOD2 anticorps

Épitope: C-Term

Fonction: Superoxide Dismutase 2 Antibody / SOD2

Séquence: QYKNVRPDYL KAIWNVINWE NVTERYMACK K

Purification: Antigen affinity purified

Immunogène: C-terminal amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK were used as the immunogen for the Superoxide Dismutase 2 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the Superoxide Dismutase 2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Superoxide Dismutase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SOD2

Antigène: SOD2 (Superoxide Dismutase 2, Mitochondrial (SOD2))

Autre désignation: Superoxide Dismutase 2

Sujet: SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.

UniProt: P04179

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis, Negative Regulation of intrinsic apoptotic Signaling