ALDH2 anticorps

N° du produit ABIN7879939

Cet anticorps anti-ALDH2 Monoclonal Souris (Clone 5G7) (ABIN7879939) détecte spécifiquement ALDH2 dans WB, IF et FACS. L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ALDH2 anticorps (ABIN7879939)

Antigène: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ALDH2 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 5G7

Détail du produit anti-ALDH2 anticorps

Fonction: ALDH2 Antibody

Séquence: SAAATQAVPA PNQQPEVFCN QIFINNEWHD A

Purification: Affinity purified

Immunogène: Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.

Isotype: IgG2a

Information d'application

Indications d'application: Optimal dilution of the ALDH2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ALDH2

Antigène: ALDH2 (Aldehyde Dehydrogenase 2 Family (Mitochondrial) (ALDH2))

Autre désignation: ALDH2

Sujet: ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60 % , most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

UniProt: P05091