ABCC2 anticorps

N° du produit ABIN7880022

L’anticorps anti-ABCC2 Polyclonal Lapin est utilisé pour la détection de ABCC2 dans des échantillons de Humain. Il a été validé pour WB et IHC (p).

Aperçu rapide pour ABCC2 anticorps (ABIN7880022)

Antigène: ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2 (ABCC2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ABCC2 anticorps

Fonction: MRP2 Antibody / Multidrug resistance-associated protein 2 / ABCC2

Séquence: AIRHDCNFDK AMQFSEASFT WEHDSEATVR DVNLD

Purification: Antigen affinity purified

Immunogène: Amino acids AIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD from the human protein were used as the immunogen for the MRP2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the MRP2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the MRP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ABCC2

Antigène: ABCC2 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 2 (ABCC2))

Autre désignation: MRP2

Sujet: Multidrug resistance-associated protein 2 (MRP2), also called canalicular multispecific organic anion transporter 1 (cMOAT) or ATP-binding cassette sub-family C member 2 (ABCC2), is a protein that in humans is encoded by the ABCC2 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is expressed in the canalicular (apical) part of the hepatocyte and functions in biliary transport. Substrates include anticancer drugs such as vinblastine, therefore, this protein appears to contribute to drug resistance in mammalian cells. Several different mutations in this gene have been observed in patients with Dubin-Johnson syndrome (DJS), an autosomal recessive disorder characterized by conjugated hyperbilirubinemia.

UniProt: Q92887

Pathways: Hormone Transport