CRB1 anticorps

N° du produit ABIN7880515

Cet anticorps anti-CRB1 Polyclonal Lapin (ABIN7880515) détecte spécifiquement CRB1 dans WB, IHC (p) et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CRB1 anticorps (ABIN7880515)

Antigène: CRB1 (Crumbs Homolog 1 (CRB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRB1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-CRB1 anticorps

Fonction: CRB1 Antibody

Séquence: FRTRDANVII LHAEKEPEFL NISIQDSRLF FQLQ

Purification: Affinity purified

Immunogène: Amino acids FRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQ from the human protein were used as the immunogen for the CRB1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CRB1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: Store the CRB1 antibody at -20oC.

Détails sur CRB1

Antigène: CRB1 (Crumbs Homolog 1 (CRB1))

Autre désignation: CRB1

Sujet: Crumbs homolog 1 is a protein that in humans is encoded by the CRB1 gene. This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.

UniProt: P82279

Pathways: Signalisation Notch