Cyclin T1 anticorps

N° du produit ABIN7880530

Cet anticorps anti-Cyclin T1 Monoclonal Souris (Clone 3B7) (ABIN7880530) détecte spécifiquement Cyclin T1 dans WB et FACS. L’anticorps est réactif avec des échantillons de Humain et Singe.

Aperçu rapide pour Cyclin T1 anticorps (ABIN7880530)

Antigène: Cyclin T1 (CCNT1)

Reactivité: Humain, Singe

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Cyclin T1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Clone: 3B7

Détail du produit anti-Cyclin T1 anticorps

Fonction: CCNT1 Antibody / Cyclin-T1

Séquence: QKQNSKSVPS AKVSLKEYRA KHAEELQKRQ LENM

Purification: Antigen affinity purified

Immunogène: Amino acids QKQNSKSVPSAKVSLKEYRAKHAEELQKRQLENM from the human protein were used as the immunogen for the CCNT1 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the CCNT1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the CCNT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Cyclin T1

Antigène: Cyclin T1 (CCNT1)

Autre désignation: CCNT1

Sujet: Cyclin-T1 is a protein that in humans is encoded by the CCNT1 gene. This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.

UniProt: O60563