EEF2 anticorps

N° du produit ABIN7880743

Cet anticorps anti-EEF2 Polyclonal Lapin (ABIN7880743) détecte spécifiquement EEF2 dans WB, IF, IHC (p) et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat et Singe.

Aperçu rapide pour EEF2 anticorps (ABIN7880743)

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Reactivité: Humain, Souris, Rat, Singe

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EEF2 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-EEF2 anticorps

Fonction: Elongation factor 2 Antibody / EEF2

Séquence: QTETVLRQAI AERIKPVLMM NKMDRALLEL QLEPEELYQT FQR

Purification: Affinity purified

Immunogène: Amino acids QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR from the human protein were used as the immunogen for the Elongation factor 2 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Elongation factor 2 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Elongation factor 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur EEF2

Antigène: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Autre désignation: Elongation factor 2

Sujet: Eukaryotic elongation factor 2 is a protein that in humans is encoded by the EEF2 gene. This gene encodes a member of the GTP-binding translation elongation factor family. This protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

UniProt: P13639

Pathways: AMPK Signaling