Fibrinogen beta Chain anticorps

N° du produit ABIN7880786

Cet anticorps Souris Monoclonal détecte spécifiquement Fibrinogen beta Chain dans WB et IHC (p). Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour Fibrinogen beta Chain anticorps (ABIN7880786)

Antigène: Fibrinogen beta Chain (FGB)

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Fibrinogen beta Chain est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone: 6D12

Détail du produit anti-Fibrinogen beta Chain anticorps

Fonction: FGB Antibody / Fibrinogen beta chain

Séquence: TNLRVLRSIL ENLRSKIQKL ESDVSAQMEY CRT

Purification: Affinity purified

Immunogène: Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the FGB antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Fibrinogen beta Chain

Antigène: Fibrinogen beta Chain (FGB)

Autre désignation: FGB

Sujet: Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

UniProt: P02675