HMGB3 anticorps

N° du produit ABIN7881047

Cet anticorps Souris Monoclonal détecte spécifiquement HMGB3 dans WB, IHC (p), IF et FACS. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour HMGB3 anticorps (ABIN7881047)

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp HMGB3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 7G13

Détail du produit anti-HMGB3 anticorps

Fonction: HMGB3 Antibody / HMG4

Séquence: EMAKADKVRY DREMKDYGPA KGGKKKKDPN APKR

Purification: Affinity purified

Immunogène: Amino acids EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR from the human protein were used as the immunogen for the HMGB3 antibody.

Isotype: IgG2b

Information d'application

Indications d'application: Optimal dilution of the HMGB3 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HMGB3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HMGB3

Antigène: HMGB3 (High Mobility Group Box 3 (HMGB3))

Autre désignation: HMGB3

Sujet: High-mobility group protein B, also known as HMG4, is a protein that in humans is encoded by the HMGB3 gene. This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.

UniProt: O15347