HAS1 anticorps

N° du produit ABIN7881135

L’anticorps anti-HAS1 Polyclonal Lapin est utilisé pour la détection de HAS1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, ICC, IF et IHC (p).

Aperçu rapide pour HAS1 anticorps (ABIN7881135)

Antigène: HAS1 (Hyaluronan Synthase 1 (HAS1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HAS1 est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-HAS1 anticorps

Fonction: HAS1 Antibody / Hyaluronan synthase 1

Séquence: NRAEDLYMVD MFREVFADED PATYVWDGNY HQPWEPA

Purification: Antigen affinity purified

Immunogène: Amino acids NRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPA were used as the immunogen for the HAS1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the HAS1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the HAS1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur HAS1

Antigène: HAS1 (Hyaluronan Synthase 1 (HAS1))

Autre désignation: HAS1

Sujet: Hyaluronan synthase 1 is an enzyme that in humans is encoded by the HAS1 gene. This gene is mapped to 19q13.41. Hyaluronan or hyaluronic acid (HA) is a high molecular weight unbranched polysaccharide synthesized by a wide variety of organisms from bacteria to mammals, and is a constituent of the extracellular matrix. It consists of alternating glucuronic acid and N-acetylglucosamine residues that are linked by beta-1-3 and beta-1-4 glycosidic bonds. It serves a variety of functions, including space filling, lubrication of joints, and provision of a matrix through which cells can migrate. HA is actively produced during wound healing and tissue repair to provide a framework for ingrowth of blood vessels and fibroblasts. AS1 is a member of the newly identified vertebrate gene family encoding putative hyaluronan synthases, and its amino acid sequence shows significant homology to the hasA gene product of Streptococcus pyogenes, a glycosaminoglycan synthetase (DG42) from Xenopus laevis, and a recently described murine hyaluronan synthase.

UniProt: Q92839

Pathways: Glycosaminoglycan Metabolic Process