Isocitrate Dehydrogenase anticorps

N° du produit ABIN7881330

Cet anticorps Souris Monoclonal détecte spécifiquement Isocitrate Dehydrogenase dans WB, IF et FACS. Il présente une réactivité avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour Isocitrate Dehydrogenase anticorps (ABIN7881330)

Antigène: Isocitrate Dehydrogenase (IDH)

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Isocitrate Dehydrogenase est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Flow Cytometry (FACS)

Clone: 16H7

Détail du produit anti-Isocitrate Dehydrogenase anticorps

Fonction: Isocitrate Dehydrogenase Antibody / IDH1

Séquence: KGLPNVQRSD YLNTFEFMDK LGENLKIKLA QAK

Purification: Affinity purified

Immunogène: Amino acids KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK from the human protein were used as the immunogen for the Isocitrate Dehydrogenase antibody.

Isotype: IgG1

Information d'application

Indications d'application: Optimal dilution of the Isocitrate Dehydrogenase antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Isocitrate Dehydrogenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Isocitrate Dehydrogenase

Antigène: Isocitrate Dehydrogenase (IDH)

Autre désignation: Isocitrate Dehydrogenase

Sujet: Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

UniProt: O75874