PRDM14 anticorps

N° du produit ABIN7882022

Cet anticorps anti-PRDM14 Polyclonal Lapin (ABIN7882022) détecte spécifiquement PRDM14 dans WB, IF, IHC (p) et FACS. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PRDM14 anticorps (ABIN7882022)

Antigène: PRDM14 (PR Domain Containing 14 (PRDM14))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRDM14 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS)

Détail du produit anti-PRDM14 anticorps

Fonction: PRDM14 Antibody

Séquence: QNLAAYYTPF PSYGHYRNSL ATVEEDFQPF RQLEA

Purification: Antigen affinity purified

Immunogène: Amino acids QNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEA were used as the immunogen for the PRDM14 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PRDM14 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the PRDM14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur PRDM14

Antigène: PRDM14 (PR Domain Containing 14 (PRDM14))

Autre désignation: PRDM14

Sujet: This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this gene may play a role in breast cancer.

UniProt: Q9GZV8