SARS-CoV-2 NSP13 anticorps

N° du produit ABIN7882198

L’anticorps anti-SARS-CoV-2 NSP13 Polyclonal Lapin est utilisé pour la détection de SARS-CoV-2 NSP13 dans des échantillons de Humain. Il a été validé pour ELISA.

Aperçu rapide pour SARS-CoV-2 NSP13 anticorps (ABIN7882198)

Antigène: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SARS-CoV-2 NSP13 est non-conjugé

Application: ELISA

Détail du produit anti-SARS-CoV-2 NSP13 anticorps

Fonction: SARS-CoV-2 Helicase Antibody / NSP13

Purification: Affinity purified

Immunogène: Amino acids YDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEE
TFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNggggPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVA
ITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ were used as the immunogen for the SARS-CoV-2 Helicase antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the SARS-CoV-2 Helicase antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the SARS-CoV-2 Helicase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur SARS-CoV-2 NSP13

Antigène: SARS-CoV-2 NSP13 (HEL) (SARS-CoV-2 Helicase (NSP13) (HEL))

Autre désignation: SARS-CoV-2 Helicase

Classe de substances: Viral Protein

Sujet: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

UniProt: P0DTD1