Vinexin anticorps

N° du produit ABIN7882336

L’anticorps anti-Vinexin Polyclonal Lapin est utilisé pour la détection de Vinexin dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB, IHC (p), IF et FACS.

Aperçu rapide pour Vinexin anticorps (ABIN7882336)

Antigène: Vinexin (Sorbs3) (Sorbin and SH3 Domain Containing 3 (Sorbs3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Vinexin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Immunofluorescence (IF), Flow Cytometry (FACS)

Détail du produit anti-Vinexin anticorps

Fonction: Vinexin Antibody / SORBS3

Séquence: ASTKIPASQH TQNWSATWTK DSKRRDKRWV KYE

Purification: Affinity purified

Immunogène: Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein were used as the immunogen for the Vinexin antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Vinexin antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the Vinexin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur Vinexin

Antigène: Vinexin (Sorbs3) (Sorbin and SH3 Domain Containing 3 (Sorbs3))

Autre désignation: Vinexin

Sujet: Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene.

UniProt: O60504

Pathways: Signalisation MAPK