ULK1 anticorps

N° du produit ABIN7882638

Cet anticorps Lapin Polyclonal détecte spécifiquement ULK1 dans WB, FACS et IHC (p). Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ULK1 anticorps (ABIN7882638)

Antigène: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ULK1 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ULK1 anticorps

Fonction: ULK1 Antibody

Séquence: EETLMEQEHT EILRGLRFTL LFVQHVLEIA ALK

Purification: Affinity purified

Immunogène: Amino acids EETLMEQEHTEILRGLRFTLLFVQHVLEIAALK from the human protein were used as the immunogen for the ULK1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the ULK1 antibody should be determined by the researcher.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: 4 °C,-20 °C

Stockage commentaire: After reconstitution, the ULK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Détails sur ULK1

Antigène: ULK1 (Unc-51 Like Kinase 1 (ULK1))

Autre désignation: ULK1

Sujet: ULK1 is an enzyme that in humans is encoded by the ULK1 gene. It is mapped to 12q24.33. Unc-51 like autophagy activating kinase (ULK1/2) are two similar isoforms of an enzyme that in humans are encoded by the ULK1/2 genes. It is specifically a kinase that is involved with autophagy, particularly in response to amino acid withdrawal. Not many studies have been done comparing the two isoforms, but some differences have been recorded.

UniProt: O75385

Pathways: Regulation of Cell Size, Autophagy