DLG3 anticorps (N-Term)

N° du produit ABIN7884915

Cet anticorps Lapin Polyclonal détecte spécifiquement DLG3 dans WB et IHC. Il présente une réactivité avec des échantillons de Souris.

Aperçu rapide pour DLG3 anticorps (N-Term) (ABIN7884915)

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLG3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Classe de qualité: Carrier-free

Détail du produit anti-DLG3 anticorps

Épitope: AA 93-124, N-Term

Fonction: A Rabbit Polyclonal Antibody to SAP-102

Homologie: Rat,mouse - 26,32 amino acid residues identical

Purification: The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Immunogène: GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102

Isotype: IgG

Information d'application

Indications d'application:

WB: 1:400

FC: The optimal concentration should be determined by the user

ICC: The optimal concentration should be determined by the user

IHC: The optimal concentration should be determined by the user

IP: The optimal concentration should be determined by the user

Commentaires:

Negative Control: (ABIN7235227)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: 0.2 mL double distilled water (DDW)

Concentration: 1 mg/mL

Buffer: PBS pH 7.4

Agent conservateur: Without preservative

Stock: -20 °C

Stockage commentaire: The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Détails sur DLG3

Antigène: DLG3 (Discs, Large Homolog 3 (DLG3))

Autre désignation: Synapse-associated protein 102

Sujet:

Synonyms: Synapse-associated protein 102, SAP-102, Discs large homolog 3, DLG3, NE-DLG

Description: SAP-102 (also known as DLG3) is a PDZ containing domain protein that is also a member of the membrane-associated guanylate kinase (MAGUK) family of multi-domain adaptor proteins1,2.PDZ domains are conserved protein domains of about 90 amino acids involved in protein-protein recognition, protein targeting and assembly of multi-protein complexes. The name PDZ derives from the first three proteins in which these domains were identified: PSD-95 (a 95 kDa protein involved in signaling at the post-synaptic density), DLG (the Drosophila melanogaster Discs large protein) and ZO-1 (the zonula occludens 1 protein involved in maintenance of epithelial polarity)1,2.MAGUKs are scaffolding proteins that comprise several modular protein binding motifs including one or more PDZ domains, a Src homology 3 (SH3) domain, and a catalytically inactive guanylate kinase-like domain1,2.The multidomain nature of PDZ-containing proteins enables them to interact with multiple binding partners and hence organize larger signaling protein complexes.SAP-102 has been shown to participate in the postsynaptic density, a dedicated structure formed in postsynaptic nerve terminals that includes a specialized assembly of ion channels, receptors and signaling molecules that are involved in information processing and the modulation of synaptic plasticity1,2. Moreover, mutations in the SAP102 gene have been linked with a form of mental retardation3.

ID gène: 1741

UniProt: Q92796