Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

GNAQ anticorps

Cet anticorps anti-GNAQ Monoclonal Souris (Clone 13H4) (ABIN8093223) détecte spécifiquement GNAQ dans WB, FACS et IHC (p). L’anticorps est réactif avec des échantillons de Humain, Souris, Rat et Singe.
N° du produit ABIN8093223
644,88 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 6 à 9 jours ouvrables

Aperçu rapide pour GNAQ anticorps (ABIN8093223)

Antigène

Voir toutes GNAQ Anticorps
GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivité

  • 99
  • 47
  • 45
  • 14
  • 6
  • 5
  • 5
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
Humain, Souris, Rat, Singe

Hôte

  • 69
  • 31
  • 1
Souris

Clonalité

  • 58
  • 43
Monoclonal

Conjugué

  • 41
  • 7
  • 6
  • 5
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Cet anticorp GNAQ est non-conjugé

Application

  • 64
  • 26
  • 25
  • 23
  • 13
  • 13
  • 13
  • 8
  • 6
  • 3
Western Blotting (WB), Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Clone

13H4
  • Fonction

    GNAQ Antibody / Guanine nucleotide binding protein Gq subunit alpha

    Séquence

    KYEHNKAHAQ LVREVDVEKV SAFENPYVDA IKSLWND

    Purification

    Purified

    Immunogène

    Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND from the human protein were used as the immunogen for the GNAQ antibody.

    Isotype

    IgG2b
  • Indications d'application

    Optimal dilution of the GNAQ antibody should be determined by the researcher.

    Restrictions

    For Research Use only
  • Format

    Lyophilized

    Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Stock

    4 °C,-20 °C

    Stockage commentaire

    After reconstitution, the GNAQ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
  • Antigène

    GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

    Autre désignation

    GNAQ

    Sujet

    GNAQ Antibody targets Guanine nucleotide binding protein Gq subunit alpha, a heterotrimeric G protein alpha subunit encoded by the GNAQ gene. GNAQ is a member of the Gq family of G proteins that couple activated G protein-coupled receptors to downstream intracellular signaling pathways. Upon receptor stimulation, GNAQ exchanges GDP for GTP and dissociates from the beta-gamma complex, allowing it to activate effector enzymes that regulate second messenger production. This signaling mechanism plays a central role in transducing extracellular cues into coordinated cellular responses.

    Guanine nucleotide binding protein Gq subunit alpha primarily functions by activating phospholipase C beta isoforms. Activation of phospholipase C beta leads to hydrolysis of phosphatidylinositol 4,5-bisphosphate, generating inositol 1,4,5-trisphosphate and diacylglycerol. These second messengers promote intracellular calcium release and activation of protein kinase C, respectively. Through this pathway, GNAQ influences diverse biological processes including cell proliferation, differentiation, secretion, and cytoskeletal dynamics. A short functional summary is that GNAQ serves as a molecular switch linking receptor activation to calcium-dependent and protein kinase C-mediated signaling cascades.

    GNAQ is broadly expressed across many tissues and cell types, reflecting its involvement in multiple physiological systems. It is found in epithelial cells, endothelial cells, immune cells, and neurons, with localization predominantly at the cytoplasmic face of the plasma membrane where G protein-coupled receptors reside. Expression and activity of GNAQ are dynamically regulated in response to extracellular ligands such as hormones, neurotransmitters, and growth factors, enabling precise control of signal amplitude and duration.

    From a disease relevance perspective, dysregulation of GNAQ signaling has been associated with several pathological conditions. Somatic activating mutations in GNAQ have been identified in uveal melanoma and other vascular and melanocytic disorders, where constitutive activation of downstream signaling promotes abnormal cell growth and survival. Altered GNAQ-mediated signaling has also been examined in cardiovascular disease, inflammatory responses, and neurological signaling pathways. These findings underscore the importance of tightly regulated GNAQ activity for maintaining cellular homeostasis.

    A GNAQ Antibody is a useful research tool for detecting guanine nucleotide binding protein Gq subunit alpha expression and studying its regulation in cellular and tissue-based systems. Detection of GNAQ supports investigations into G protein-coupled receptor signaling, calcium-mediated signal transduction, and disease-associated alterations in Gq pathway activity. This antibody targets guanine nucleotide binding protein Gq subunit alpha for use in research applications focused on signal transduction and cell communication biology.

    UniProt

    P50148

    Pathways

    Signalistation JAK/STAT, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction
Vous êtes ici:
Chat with us!