CDKN2C anticorps

N° du produit ABIN8098208

L’anticorps anti-CDKN2C Polyclonal Lapin est utilisé pour la détection de CDKN2C dans des échantillons de Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Porc et Lapin. Il a été validé pour IHC.

Aperçu rapide pour CDKN2C anticorps (ABIN8098208)

Antigène: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Cheval, Porc, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDKN2C est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-CDKN2C anticorps

Fonction: CDKN2C Antibody

Séquence: VMKLGNPEIA RRLLLRGANP DLKDRTGFAV IHDAARAGFL DTLQTLLEFQ

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 92%, Horse: 100%, Human: 100%, Mouse: 91%, Pig: 100%, Rabbit: 100%, Rat: 92%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence VMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQ

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP30196-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur CDKN2C

Antigène: CDKN2C (Cyclin-Dependent Kinase Inhibitor 2C (p18, Inhibits CDK4) (CDKN2C))

Autre désignation: CDKN2C

Sujet:

Background Information: The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Gene Name: cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)

Alternative Symbols: p18, INK4C, p18-INK4C

Protein Name: Cyclin-dependent kinase 4 inhibitor C

Poids moléculaire: 18 kDa

ID gène: 1031

NCBI Accession: NP_001253

UniProt: P42773

Pathways: Cycle Cellulaire, Mitotic G1-G1/S Phases