YES1 anticorps

N° du produit ABIN8115600

Cet anticorps anti-YES1 Polyclonal Lapin (ABIN8115600) détecte spécifiquement YES1 dans IHC. L’anticorps est réactif avec des échantillons de Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Boeuf (Vache), Cobaye, Cheval et Lapin.

Aperçu rapide pour YES1 anticorps (ABIN8115600)

Antigène: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Boeuf (Vache), Cobaye, Cheval, Lapin

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YES1 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-YES1 anticorps

Fonction: YES1 Antibody

Séquence: EQVERGYRMP CPQGCPESLH ELMNLCWKKD PDERPTFEYI QSFLEDYFTA

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Zebrafish: 93%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTA

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63762-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur YES1

Antigène: YES1 (V-Yes-1 Yamaguchi Sarcoma Viral Oncogene Homolog 1 (YES1))

Autre désignation: YES1

Sujet:

Background Information: This gene is the cellular homolog of the Yamaguchi sarcoma virus oncogene. The encoded protein has tyrosine kinase activity and belongs to the src family of proteins. This gene lies in close proximity to thymidylate synthase gene on chromosome 18, and a corresponding pseudogene has been found on chromosome 22.

Gene Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1

Alternative Symbols: Yes, c-yes, HsT441, P61-YES

Protein Name: Tyrosine-protein kinase Yes

Poids moléculaire: 61 kDa

ID gène: 7525

NCBI Accession: NP_005424

UniProt: P07947

Pathways: CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Thromboxane A2 Receptor Signaling