WASF1 anticorps

N° du produit ABIN8115785

L’anticorps anti-WASF1 Polyclonal Lapin est utilisé pour la détection de WASF1 dans des échantillons de Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Saccharomyces cerevisiae et Poisson zèbre (Danio rerio). Il a été validé pour IHC.

Aperçu rapide pour WASF1 anticorps (ABIN8115785)

Antigène: WASF1 (WAS Protein Family, Member 1 (WASF1))

Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Saccharomyces cerevisiae, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WASF1 est non-conjugé

Application: Immunohistochemistry (IHC)

Détail du produit anti-WASF1 anticorps

Fonction: WASF1 Antibody

Séquence: TPYRDDGKEG LKFYTNPSYF FDLWKEKMLQ DTEDKRKEKR KQKQKNLDRP

Homologie: Cow: 100%, Dog: 100%, Guinea Pig: 100%, Horse: 100%, Human: 100%, Mouse: 100%, Rabbit: 100%, Rat: 100%, Yeast: 83%, Zebrafish: 92%

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

We also sell a specific blocking peptide that can be used in combination with this antibody. You can find the blocking peptide under AAP63994-100UG

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 0.5 mg/mL

Buffer: Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: prevent freeze-thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20 °C in small aliquots to prevent freeze-thaw cycles.

Détails sur WASF1

Antigène: WASF1 (WAS Protein Family, Member 1 (WASF1))

Autre désignation: WASF1

Sujet:

Background Information: The protein encoded by this gene, a member of the Wiskott-Aldrich syndrome protein (WASP)-family, plays a critical role downstream of Rac, a Rho-family small GTPase, in regulating the actin cytoskeleton required for membrane ruffling. It has been shown to associate with an actin nucleation core Arp2/3 complex while enhancing actin polymerization in vitro. Wiskott-Aldrich syndrome is a disease of the immune system, likely due to defects in regulation of actin cytoskeleton. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Gene Name: WAS protein family, member 1

Alternative Symbols: WAVE, SCAR1, WAVE1, NEDALVS

Protein Name: Wiskott-Aldrich syndrome protein family member 1

Poids moléculaire: 62 kDa

ID gène: 8936

NCBI Accession: NP_003922

UniProt: Q92558

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization