CXCL12 Protéine

N° du produit ABIN7866195

Cette protéine Recombinant CXCL12 est exprimée dans Escherichia coli (E. coli).

Aperçu rapide pour CXCL12 Protéine (ABIN7866195)

Antigène: CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (CXCL12))

Type de proteíne: Recombinant

Origine: Humain

Source: Escherichia coli (E. coli)

Application: Activation (Act), Cellular Assay (CA)

Pureté: > 95 % It contains no nucleic acids.

Détail du produit

Fonction: SDF1 – Stromal Cell-Derived Factor 1α ( CXCL12) tested in migration, LPS-Free

Séquence: CXCL12 consists of 69 amino acid residues: MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Attributs du produit: Recombinant Stromal Cell-Derived Factor 1α (SDF-1alpha) is a 8 kDa chemokine protein expressed in many tissues and cell types. The protein is almost identical (92% homology) in human, mouse and rat.
The chemokine SDF-1α binds to the chemokine receptor CXCR4 and plays an essential and unique role in homeostatic regulation of leukocyte traffic, hematopoiesis, organogenesis, cell differentiation and tissue regeneration (Murphy, 2002).
SDF-1alpha forms an heterocomplex with the alarmin HMGB1 (High Mobility Group 1) to promote the recruitment of cells via CXCR4 receptor.

Purification: Purified

niveau d'endotoxine: LPS-free: Pierce™ Chromogenic Endotoxin Quant Kit, <0.1 EU/mL

Information d'application

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: The lyophilized protein once reconstituted with distilled water will be dissolved in a solution of DPBS without Ca and Mg.

Buffer: The product contains contains < 0.006% v/v of Triton X-114 due to LPS removal. Remaining traces can be removed upon request.

Stock: 4 °C/-20 °C

Stockage commentaire: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.

Détail du antigène

Antigène: CXCL12 (Chemokine (C-X-C Motif) Ligand 12 (CXCL12))

Autre désignation: SDF1 alpha

Poids moléculaire: 8 kDa

Pathways: Regulation of Cell Size, CXCR4-mediated Signaling Events, Negative Regulation of intrinsic apoptotic Signaling