Lamin B1 anticorps (Middle Region)
Aperçu rapide pour Lamin B1 anticorps (Middle Region) (ABIN630637)
Antigène
Voir toutes Lamin B1 (LMNB1) AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- Lamin B1 antibody was raised against the middle region of LMNB1
-
Purification
- Affinity purified
-
Immunogène
- Lamin B1 antibody was raised using the middle region of LMNB1 corresponding to a region with amino acids EEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM
-
-
anti-Lamin B1 (LMNB1) (AA 397-586) antibody
LMNB1 Reactivité: Humain WB, IHC, IP, IF Hôte: Lapin Polyclonal unconjugated
anti-Lamin B1 (LMNB1) (AA 266-583) antibodyLMNB1 Reactivité: Humain, Souris, Rat WB, IHC, IP, ICC, IF, FACS Hôte: Lapin Polyclonal unconjugated
anti-Lamin B1 (LMNB1) (AA 52-233) antibodyLMNB1 Reactivité: Humain WB Hôte: Souris Monoclonal C2 unconjugated
anti-Lamin B1 (LMNB1) (AA 107-186) antibodyLMNB1 Reactivité: Humain WB, ELISA, IP, IF Hôte: Souris Monoclonal 4B10 unconjugated
anti-Lamin B1 (LMNB1) (AA 107-186) antibodyLMNB1 Reactivité: Humain WB, ELISA, IF, IHC (p) Hôte: Souris Monoclonal 4E4 unconjugated
anti-Lamin B1 (LMNB1) (AA 450-500) antibodyLMNB1 Reactivité: Humain, Souris WB, IHC, ICC Hôte: Lapin Monoclonal BLR368N unconjugated Recombinant Antibody
anti-Lamin B1 (LMNB1) (AA 450-500) antibodyLMNB1 Reactivité: Humain, Souris WB, IHC, ICC Hôte: Lapin Monoclonal BLR368N unconjugated Recombinant Antibody
anti-Lamin B1 (LMNB1) (AA 570-586), (C-Term) antibodyLMNB1 Reactivité: Humain, Souris, Rat WB, IHC, ICC, IF Hôte: Lapin Polyclonal unconjugated
anti-Lamin B1 (LMNB1) (AA 570-586) antibodyLMNB1 Reactivité: Humain, Souris, Rat WB, IP, IF, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Lamin B1 (LMNB1) antibodyLMNB1 Reactivité: Humain WB, IHC Hôte: Lapin Monoclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
Lamin B1 Blocking Peptide, (ABIN937779), is also available for use as a blocking control in assays to test for specificity of this Lamin B1 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMNB1 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Lamin B1 (LMNB1)
-
Autre désignation
- Lamin B1
-
Sujet
- LAMNB1 encodes for one of the two B type proteins of the nuclear lamina, B1. The Vertebrate lamins consist of two types, A and B. The nuclear lamina consists of a two-dimensional matrix of proteins located next to the inner nuclear membrane. The lamin family of proteins make up the matrix and are highly conserved in evolution. During mitosis, the lamina matrix is reversibly disassembled as the lamin proteins are phosphorylated. Lamin proteins are thought to be involved in nuclear stability, chromatin structure and gene expression.
-
Poids moléculaire
- 66 kDa (MW of target protein)
-
Pathways
- Apoptose, Caspase Cascade in Apoptosis
Antigène
-
