XRCC2 anticorps (Middle Region)
Aperçu rapide pour XRCC2 anticorps (Middle Region) (ABIN634115)
Antigène
Voir toutes XRCC2 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- XRCC2 antibody was raised against the middle region of XRCC2
-
Purification
- Affinity purified
-
Immunogène
- XRCC2 antibody was raised using the middle region of XRCC2 corresponding to a region with amino acids CLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFA
-
-
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) antibody
XRCC2 Reactivité: Humain, Souris, Rat WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (AA 1-280) antibodyXRCC2 Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 2H4 unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (AA 1-30), (N-Term) antibodyXRCC2 Reactivité: Humain WB Hôte: Lapin Polyclonal RB30583 unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (N-Term) antibodyXRCC2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (C-Term) antibodyXRCC2 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) antibodyXRCC2 Reactivité: Humain WB, FACS Hôte: Lapin Monoclonal 25GB1995 unconjugated Recombinant Antibody
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (AA 1-280) antibodyXRCC2 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (AA 1-280) antibodyXRCC2 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (C-Term) antibodyXRCC2 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2) (AA 211-260) antibodyXRCC2 Reactivité: Humain ELISA, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
XRCC2 Blocking Peptide, (ABIN937126), is also available for use as a blocking control in assays to test for specificity of this XRCC2 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC2 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- XRCC2 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 2 (XRCC2))
-
Autre désignation
- XRCC2
-
Sujet
- XRCC2 is a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene is involved in the repair of DNA double-strand breaks by homologous recombination and it functionally complements Chinese hamster irs1, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents.
-
Poids moléculaire
- 31 kDa (MW of target protein)
-
Pathways
- Réparation de l'ADN
Antigène
-
