XRCC4 anticorps (Middle Region)
Aperçu rapide pour XRCC4 anticorps (Middle Region) (ABIN630879)
Antigène
Voir toutes XRCC4 AnticorpsReactivité
Hôte
Clonalité
Conjugué
Application
-
-
Épitope
- Middle Region
-
Specificité
- XRCC4 antibody was raised against the middle region of XRCC4
-
Purification
- Affinity purified
-
Immunogène
- XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS
-
-
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (AA 1-336) antibody
XRCC4 Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (AA 1-336) antibodyXRCC4 Reactivité: Humain WB, IF, IHC (p) Hôte: Souris Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (C-Term) antibodyXRCC4 Reactivité: Humain WB, IF, IHC (p), ICC Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (AA 53-168) antibodyXRCC4 Reactivité: Humain WB, IF Hôte: Souris Monoclonal 4-XRCC4 unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) antibodyXRCC4 Reactivité: Humain WB, IF, IP, IHC (p) Hôte: Souris Monoclonal 8K2 unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (AA 1-336) antibodyXRCC4 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) antibodyXRCC4 Reactivité: Humain WB, IHC, IF, IP Hôte: Souris Monoclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) (AA 151-260) antibodyXRCC4 Reactivité: Humain, Rat WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) antibodyXRCC4 Reactivité: Humain WB, ELISA, IP Hôte: Souris Monoclonal unconjugated
anti-X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4) antibodyXRCC4 Reactivité: Humain WB, IP Hôte: Souris Monoclonal 5C10 unconjugated
-
-
Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Commentaires
-
XRCC4 Blocking Peptide, (ABIN5617046), is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody
-
Restrictions
- For Research Use only
-
-
-
Format
- Lyophilized
-
Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC4 antibody in PBS
-
Concentration
- Lot specific
-
Buffer
- PBS
-
Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Stock
- 4 °C/-20 °C
-
Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- XRCC4 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 4 (XRCC4))
-
Autre désignation
- XRCC4
-
Sujet
- XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.
-
Poids moléculaire
- 38 kDa (MW of target protein)
-
Pathways
- Réparation de l'ADN, Production of Molecular Mediator of Immune Response
Antigène
-
