anti-Humain TECTA anticorps pour Immunohistochemistry (Paraffin-embedded Sections)

Recommended TECTA Antibody (fourni par: Connectez-vous pour afficher )

Antigène
Tectorin alpha (TECTA) Anticorps
  • DFNA12
  • DFNA8
  • DFNB21
  • Tctna
  • tectorin alpha
  • TECTA
  • Tecta
Épitope
AA 93-134, N-Term
3
2
1
1
Reactivité
Humain, Souris, Rat (Rattus)
8
1
1
Hôte
Lapin
5
3
Clonalité
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
5
5
1
1
1
1
Options
Fournisseur
Connectez-vous pour afficher
Supplier Product No.
Connectez-vous pour afficher
Request

Recevoir ce produit gratuitement

Envoyez-nous votre proposition de validation. J'aimerais valider ce produit

Savoir plus

N° du produit ABIN5518790
$ 240.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Fournisseur Clonality References Details
1 ABIN4358355 IHC IHC (p) Rabbit IgG Connectez-vous pour afficher Polyclonal

General

Antigène Tectorin alpha (TECTA) Anticorps
Épitope AA 93-134, N-Term
(3), (2), (1), (1)
Reactivité Humain, Souris, Rat (Rattus)
(8), (1), (1)
Hôte Lapin
(5), (3)
Clonalité
Polyclonal
Application Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(5), (5), (1), (1), (1), (1)
Fournisseur Connectez-vous pour afficher

Détail du produit anti-TECTA anticorps

Détail du antigène TECTA Information d'application Stockage Images
Fonction Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Séquence RAFVAPFWAD VHNGIRGEIY YRETMEPAIL KRATKDIRKY FK
Réactivité croisée (Details) No cross reactivity with other proteins.
Attributs du produit Rabbit IgG polyclonal antibody for Alpha-tectorin(TECTA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: tectorin alpha
Protein Name: Alpha-tectorin
Purification Immunogen affinity purified.
Immunogène A synthetic peptide corresponding to a sequence at the N-terminus of human TECTA (93-134aa RAFVAPFWADVHNGIRGEIYYRETMEPAILKRATKDIRKYFK), different from the related mouse sequence by three amino acids.
Isotype IgG

Détail du antigène TECTA

Détail du produit anti-TECTA anticorps Information d'application Stockage Images Haut de la page
Antigène
Autre désignation TECTA (TECTA Antibody Extrait)
Sujet Alpha-tectorin is a protein that in humans is encoded by the TECTA gene. The tectorial membrane is an extracellular matrix of the inner ear that contacts the stereocilia bundles of specialized sensory hair cells. Sound induces movement of these hair cells relative to the tectorial membrane, deflects the stereocilia, and leads to fluctuations in hair-cell membrane potential, transducing sound into electrical signals. Alpha-tectorin is one of the major noncollagenous components of the tectorial membrane. Mutations in the TECTA gene have been shown to be responsible for autosomal dominant nonsyndromic hearing impairment and a recessive form of sensorineural pre-lingual non-syndromic deafness.

Synonyms: Alpha-tectorin | DFNA12 | DFNA8 | DFNB21 | TECTA | O75443
ID gène 7007
UniProt O75443
Pathways Sensory Perception of Sound

Information d'application

Détail du produit anti-TECTA anticorps Détail du antigène TECTA Stockage Images Haut de la page
Indications d'application WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Commentaires

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions For Research Use only

Stockage

Détail du produit anti-TECTA anticorps Détail du antigène TECTA Information d'application Images Haut de la page
Format Lyophilized
Reconstitution Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
Concentration 500 μg/mL
Buffer Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
Agent conservateur Sodium azide
Précaution d'utilisation This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Stock 4 °C,-20 °C
Stockage commentaire At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.