CGRP anticorps

N° du produit ABIN109807

Cet anticorps Chèvre Polyclonal détecte spécifiquement CGRP dans RIA. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CGRP anticorps (ABIN109807)

Antigène: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp CGRP est non-conjugé

Application: Radioimmunoassay (RIA)

Détail du produit anti-CGRP anticorps

Specificité: Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin

Immunogène: Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)

Information d'application

Indications d'application: RIA (1/3,000)

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Stock: 4 °C

Détails sur CGRP

Antigène: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Autre désignation: Calcitonin-Gene related Peptide

Sujet: Serum

ID gène: 797

Pathways: Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour