AIF anticorps (AA 151-180)

N° du produit ABIN1099879

Détail du produit anti-AIF anticorps

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Épitope: AA 151-180

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AIF est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Marque: IHC-plus™

Purification: Affinity purified

Immunogène: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA

Isotype: IgG

Information d'application

Indications d'application: Approved: IHC, IHC-P (5 μg/mL), WB

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.

Détails sur AIF

Antigène: AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))

Autre désignation: AIFM1 / AIF / PDCD8 (AIFM1 Produits)

Synonymes: anticorps AIF, anticorps CMTX4, anticorps COWCK, anticorps COXPD6, anticorps PDCD8, anticorps CG7263, anticorps DmAIF, anticorps Dmel\\CG7263, anticorps GB16024, anticorps DDBDRAFT_0187853, anticorps DDBDRAFT_0191137, anticorps DDB_0187853, anticorps DDB_0191137, anticorps aif, anticorps pdcd8, anticorps AIFM1, anticorps PCD8, anticorps AIFsh2, anticorps Hq, anticorps Pdcd8, anticorps mAIF, anticorps Aif, anticorps zgc:91994, anticorps apoptosis inducing factor mitochondria associated 1, anticorps allograft inflammatory factor 1, anticorps Apoptosis inducing factor, anticorps apoptosis-inducing factor 1, mitochondrial, anticorps apoptosis inducing factor, anticorps apoptosis inducing factor, mitochondria associated 1, anticorps apoptosis-inducing factor, mitochondrion-associated, 1, anticorps apoptosis-inducing factor, mitochondrion-associated 1, anticorps AIFM1, anticorps AIF1, anticorps AIF, anticorps LOC412212, anticorps aif, anticorps aifm1, anticorps Aifm1

Sujet: Name/Gene ID: AIFM1
Family: Apoptosis

Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8

ID gène: 9131

UniProt: O95831

Pathways: Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg