AIF anticorps (AA 151-180)
-
- Antigène Voir toutes AIF (AIFM1) Anticorps
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
-
Épitope
- AA 151-180
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AIF est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Marque
- IHC-plus™
- Purification
- Affinity purified
- Immunogène
- human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
- Isotype
- IgG
- Top Product
- Discover our top product AIFM1 Anticorps primaire
-
-
- Indications d'application
- Approved: IHC, IHC-P (5 μg/mL), WB
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- TBS containing 50 % glycerol, 0.5 mg/mL BSA, and 0.02 % sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- avoid freeze thaw cycles.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- Short term 4°C, long term aliquot and store at -20°C, avoid freeze-thaw cycles.
-
- Antigène
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
- Autre désignation
- AIFM1 / AIF / PDCD8 (AIFM1 Produits)
- Synonymes
- anticorps AIF, anticorps CMTX4, anticorps COWCK, anticorps COXPD6, anticorps PDCD8, anticorps CG7263, anticorps DmAIF, anticorps Dmel\\CG7263, anticorps GB16024, anticorps DDBDRAFT_0187853, anticorps DDBDRAFT_0191137, anticorps DDB_0187853, anticorps DDB_0191137, anticorps aif, anticorps pdcd8, anticorps AIFM1, anticorps PCD8, anticorps AIFsh2, anticorps Hq, anticorps Pdcd8, anticorps mAIF, anticorps Aif, anticorps zgc:91994, anticorps apoptosis inducing factor mitochondria associated 1, anticorps allograft inflammatory factor 1, anticorps Apoptosis inducing factor, anticorps apoptosis-inducing factor 1, mitochondrial, anticorps apoptosis inducing factor, anticorps apoptosis inducing factor, mitochondria associated 1, anticorps apoptosis-inducing factor, mitochondrion-associated, 1, anticorps apoptosis-inducing factor, mitochondrion-associated 1, anticorps AIFM1, anticorps AIF1, anticorps AIF, anticorps LOC412212, anticorps aif, anticorps aifm1, anticorps Aifm1
- Sujet
-
Name/Gene ID: AIFM1
Family: Apoptosis
Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8 - ID gène
- 9131
- UniProt
- O95831
- Pathways
- Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg
-