ITGA3 anticorps (Isoform 3A, N-Term)

N° du produit ABIN112369

Cet anticorps Souris Monoclonal détecte spécifiquement ITGA3 dans WB, IF et IHC (fro). Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour ITGA3 anticorps (Isoform 3A, N-Term) (ABIN112369)

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Reactivité: Humain, Chien

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ITGA3 est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 158A3

Détail du produit anti-ITGA3 anticorps

Épitope: Isoform 3A, N-Term

Specificité: This antibody Clone 158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated Integrin subunit α3A. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Purified

Immunogène: 158A3 is a mouse monoclonal IgG2a antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Isotype: IgG2a

Information d'application

Indications d'application: 158A3 is suitable for Immunoblotting, Immunocytochemistry, Immunohistochemistry onfrozen sections. Recommended dilutions: 1/100-1/200 for Immunohistochemistry with avidin-biotinylatedhorseradish peroxidase complex (ABC) as detection reagent, and 1/100-1/1000 forImmunoblotting applications.
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Stockage

Concentration: 1.0 mg/mL

Buffer: PBS, 0.09 % Sodium Azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: Store lyophilized (preferably in a desiccator) at 2-8 °C and reconstituted (in aliquots) at -20 °C.

Détails sur ITGA3

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Autre désignation: CD49c / ITGA3

Sujet: Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated a and b subunits. More than 18 a and 8 b subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits a3 and a6, two cytoplasmic variants, A and B, have been identified.Synonyms: CD49 antigen-like family member C, FRP-2, GAPB3, Galactoprotein B3, ITGA-3, ITGAG3, Integrin alpha-3, MSK18, VLA-3 alpha chain, VLA3

ID gène: 3675

NCBI Accession: NP_002195

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex