L’anticorps Souris Monoclonal anti-SRA1 a été validé pour WB, ELISA et IP. Il convient pour détecter SRA1 dans des échantillons de Humain, Rat et Souris. Il y a 2+ publications disponibles.
may cross-react with CYFIP 2/PIR 121 due to high sequence homology.
Immunogène
Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.
WB: 1:100 up to 1:2000, ICC: not recommended IHC: not recommended
Restrictions
For Research Use only
Format
Lyophilized
Reconstitution
For reconstitution add 100µl H2O to get a 1mg/ml solution in PBS.
Buffer
PBS. Azide was added before lyophilization.
Agent conservateur
Sodium azide
Précaution d'utilisation
This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Conseil sur la manipulation
Do not freeze! Antibodies should be stored at +4°C when still lyophilized.
Stock
-20 °C
Stockage commentaire
Reconstitute and aliquot and store at -20°C to -80°C until use. Antibodies should be stored at +4°C when still lyophilized.
Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." dans: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).
Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." dans: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).