SRA1 anticorps (AA 519-556)

N° du produit ABIN1742561

L’anticorps Souris Monoclonal anti-SRA1 a été validé pour WB, ELISA et IP. Il convient pour détecter SRA1 dans des échantillons de Humain, Rat et Souris. Il y a 2+ publications disponibles.

Aperçu rapide pour SRA1 anticorps (AA 519-556) (ABIN1742561)

Antigène: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Reactivité: Humain, Rat, Souris

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp SRA1 est non-conjugé

Application: Western Blotting (WB), ELISA, Immunoprecipitation (IP)

Clone: 30A4

Détail du produit anti-SRA1 anticorps

Épitope: AA 519-556

Specificité: Specific for Sra 1

Réactivité croisée (Details): may cross-react with CYFIP 2/PIR 121 due to high sequence homology.

Immunogène: Synthetic peptide CDWETGHEPFNDPALRGEKDPKSGFDIKVPRRAVGPSS (aa 519-556 in mouse Sra 1b) coupled to key-hole limpet hemocyanin via an internal N-terminal cysteine residue.

Isotype: IgG1

Information d'application

Indications d'application: WB: 1:100 up to 1:2000, ICC: not recommended IHC: not recommended

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: For reconstitution add 100µl H2O to get a 1mg/ml solution in PBS.

Buffer: PBS. Azide was added before lyophilization.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Do not freeze! Antibodies should be stored at +4°C when still lyophilized.

Stock: -20 °C

Stockage commentaire: Reconstitute and aliquot and store at -20°C to -80°C until use. Antibodies should be stored at +4°C when still lyophilized.

Références pour anticorps anti-SRA1 (ABIN1742561)

Bozdagi, Sakurai, Dorr, Pilorge, Takahashi, Buxbaum: "Haploinsufficiency of Cyfip1 produces fragile X-like phenotypes in mice." dans: PLoS ONE, Vol. 7, Issue 8, pp. e42422, (2012) (PubMed).

Steffen, Faix, Resch, Linkner, Wehland, Small, Rottner, Stradal: "Filopodia formation in the absence of functional WAVE- and Arp2/3-complexes." dans: Molecular biology of the cell, Vol. 17, Issue 6, pp. 2581-91, (2006) (PubMed).

Détails sur SRA1

Antigène: SRA1 (Steroid Receptor RNA Activator 1 (SRA1))

Autre désignation: Sra 1

Sujet: Synonyms: CYFIP 1

Pathways: EGFR Signaling Pathway, Stem Cell Maintenance, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development