CD59 anticorps (AA 25-104) (APC)

N° du produit ABIN1858311

Cet anticorps anti-CD59 est un anticorps Cobaye Polyclonal détectant CD59 dans WB, IHC, IP et ICC. Adapté pour Lapin.

Aperçu rapide pour CD59 anticorps (AA 25-104) (APC) (ABIN1858311)

Antigène: CD59

Reactivité: Lapin

Hôte: Cobaye

Clonalité: Polyclonal

Conjugué: Cet anticorp CD59 est conjugé à/à la APC

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP), Immunocytochemistry (ICC)

Détail du produit anti-CD59 anticorps (APC)

Épitope: AA 25-104

Fonction: Polyclonal Antibody to Cluster of Differentiation 59 (CD59)

Séquence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDD DDKAMADIGSEF-SLMCYH CLLPSPNCST VTNCTPNHDA CLTAVSGPRV YRQCWRYEDC NFEFISNRLE ENSLKYNCCR KDLCNGPEDD GTAL

Specificité: The antibody is a cavia polyclonal antibody raised against CD59. It has been selected for its ability to recognize CD59 in immunohistochemical staining and western blotting.

Purification: Antigen-specific affinity chromatography followed by Protein A affinity chromatography

Immunogène: RPB336Rb01Recombinant Cluster of Differentiation 59 (CD59)

Isotype: IgG

Information d'application

Indications d'application: Western blotting: 0.2-2 μg/mL,1:250-2500 Immunohistochemistry: 5-20 μg/mL,1:25-100 Immunocytochemistry: 5-20 μg/mL,1:25-100 Optimal working dilutions must be determined by end user.

Commentaires:

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: 500 μg/mL

Buffer: PBS, pH 7.4, containing 0.01 % SKL, 1 mM DTT, 5 % Trehalose and Proclin300.

Agent conservateur: Dithiothreitol (DTT), ProClin

Précaution d'utilisation: WARNING: Reagents contain sodium azide. Sodium azide is very toxic if ingested or inhaled. Avoid contact with skin, eyes, or clothing. Wear eye or face protection when handling. If skin or eye contact occurs, wash with copious amounts of water. If ingested or inhaled, contact a physician immediately. Sodium azide yields toxic hydrazoic acid under acidic conditions. Dilute azide-containing compounds in running water before discarding to avoid accumulation of potentially explosive deposits in lead or copper plumbing.

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C for frequent use. Stored at -20°C in a manual defrost freezer for two year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Date de péremption: 12 months

Détails sur CD59

Antigène: CD59

Autre désignation: CD59

Sujet: Protectin, MIC11, MIN1, MIN2, MIN3, MSK21, MAC-IP, MACIF, MIRL, HRF20, Complement Regulatory Protein, 20 kDa homologous restriction factor, Membrane attack complex inhibition factor

Pathways: Système du Complément