IL21 Receptor anticorps (AA 35-64)

N° du produit ABIN1905061

Cet anticorps Lapin Polyclonal détecte spécifiquement IL21 Receptor dans ELISA, IHC et FACS. Il présente une réactivité envers Souris.

Aperçu rapide pour IL21 Receptor anticorps (AA 35-64) (ABIN1905061)

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL21 Receptor est non-conjugé

Application: ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)

Détail du produit anti-IL21 Receptor anticorps

Épitope: AA 35-64

Specificité: Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.

Homologie: Percent identity by BLAST analysis: Mouse (100%) Rat (90%).

Purification: Immunoaffinity purified

Immunogène: Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%), Rat (90%).

Type of Immunogen: Synthetic peptide

Information d'application

Indications d'application: Approved: ELISA (1:100000), Flo, IHC

Commentaires:

Target Species of Antibody: Mouse

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Aliquot to Avoid freeze/thaw cycles.

Stock: -20 °C

Stockage commentaire: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Détails sur IL21 Receptor

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Autre désignation: IL21R / IL-21R

Sujet: Name/Gene ID: IL21R
Family: Interleukin

Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor

ID gène: 50615

UniProt: Q9HBE5

Pathways: Signalistation JAK/STAT