ITGA3 anticorps (Cytoplasmic Domain)

N° du produit ABIN201109

Cet anticorps Souris Monoclonal détecte spécifiquement ITGA3 dans WB, IHC, ICC et IHC (fro). Il présente une réactivité envers Humain.

Aperçu rapide pour ITGA3 anticorps (Cytoplasmic Domain) (ABIN201109)

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp ITGA3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Clone: 29A3

Détail du produit anti-ITGA3 anticorps

Épitope: Cytoplasmic Domain

Specificité: Recognizes specifically the cytoplasmic domain of human integrin subunit a3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.

Purification: Protein G purified

Immunogène: Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotype: IgG1

Information d'application

Indications d'application: Approved: ICC, IHC, IHC-Fr, WB

Usage: Immunohistochemistry (frozen): 1:100 - 1:200 using avidn-biotinylated HRP complex (ABC) as detection reagent. Western Blot: 1:100 - 1:1000. Optimum dilutions to be determined by researcher.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS,  pH 7.2, 0.1 % sodium azide. No stabilizing proteins added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeat freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: Short term: 4°C. Long term: Store at -20°C. Avoid freeze-thaw cycles.

Détails sur ITGA3

Antigène: ITGA3 (Integrin, alpha 3 (ITGA3))

Autre désignation: ITGA3 / CD49c

Sujet: Name/Gene ID: ITGA3
Family: Integrin

Synonyms: ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18

ID gène: 3675

UniProt: P26006

Pathways: CXCR4-mediated Signaling Events, Integrin Complex