IL21 Receptor anticorps (N-Term)

N° du produit ABIN7581146

Cet anticorps Chèvre Polyclonal détecte spécifiquement IL21 Receptor dans ELISA et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour IL21 Receptor anticorps (N-Term) (ABIN7581146)

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Reactivité: Humain

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp IL21 Receptor est non-conjugé

Application: ELISA, Immunohistochemistry (IHC)

Détail du produit anti-IL21 Receptor anticorps

Épitope: N-Term

Séquence: CILEMWNLHP STLTLTWQDQ YEELKDEATS

Réactivité croisée: Humain

Réactivité croisée (Details): Calculated cross reactivity: Hu

Attributs du produit: Interleukin 21 Receptor (IL-21)

Purification: Purified by immunoaffinity chromatography.

Immunogène: Synthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to 35-65 residues of N-terminus of human IL-21 receptor.

Isotype: IgG

Information d'application

Indications d'application: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Liquid

Buffer: Supplied as a liquid in PBS, 0.09 % sodium azide before the addition of 40 % glycerol. No preservative added.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: -20 °C

Stockage commentaire: -20°C

Détails sur IL21 Receptor

Antigène: IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))

Autre désignation: Interleukin 21 Receptor

Pathways: Signalistation JAK/STAT