RUNX2 anticorps (AA 244-278)

N° du produit ABIN2618054

Cet anticorps Lapin Polyclonal détecte spécifiquement RUNX2 dans WB. Il présente une réactivité envers Humain, Souris, Porc, Chimpanzé et Gibbon.

Aperçu rapide pour RUNX2 anticorps (AA 244-278) (ABIN2618054)

Antigène: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Reactivité: Humain, Souris, Porc, Chimpanzé, Gibbon

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RUNX2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RUNX2 anticorps

Épitope: AA 244-278

Specificité: Specifically expressed in osteoblasts.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human RUNX2(244-278aa DRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFN), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2 HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide per 100 μg antibody.

Agent conservateur: Sodium azide, Thimerosal (Merthiolate)

Précaution d'utilisation: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Conseil sur la manipulation: Avoid freeze-thaw cycles.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur RUNX2

Antigène: RUNX2 (Runt-Related Transcription Factor 2 (RUNX2))

Autre désignation: CBFA1 / RUNX2

Sujet: Name/Gene ID: RUNX2

Synonyms: RUNX2, AML3, CCD, CCD1, OSF2, PEBP2A1, PEBP2A2, PEA2-alpha A, PEBP2-alpha A, OSF-2, PEBP2A, PEBP2aA1, CBF-alpha-1, CBFA1, Oncogene AML-3, PEA2aA, PEBP2aA

ID gène: 860