VEGFA anticorps

N° du produit ABIN2629817

Cet anticorps anti-VEGFA est un anticorps Polyclonal produit chez le Chèvre, détectant VEGFA dans WB et IF. Convient pour Humain, Rat, Souris, Porc, Chien, Lapin, Boeuf (Vache), Poulet, Mouton, Cheval, Cobaye, Singe, Cat, Âne, Chévre et Hamster.

Aperçu rapide pour VEGFA anticorps (ABIN2629817)

Antigène: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Reactivité: Humain, Rat, Souris, Porc, Chien, Lapin, Boeuf (Vache), Poulet, Mouton, Cheval, Cobaye, Singe, Cat, Âne, Chévre, Hamster

Hôte: Chèvre

Clonalité: Polyclonal

Conjugué: Cet anticorp VEGFA est non-conjugé

Application: Western Blotting (WB), Immunofluorescence (IF)

Détail du produit anti-VEGFA anticorps

Specificité: Detects endogenous levels of total VEGFA by Western blot in whole cell and tissue lysates.

Purification: Immunoaffinity purified

Immunogène: Purified recombinant human VEGFA isoform 6 produced in E. coli. corresponding to P15692-6 (MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD)

Isotype: IgG

Information d'application

Indications d'application: Approved: IF (1:50 - 1:250), WB (1:500 - 1:2000)

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: PBS, 20 % glycerol, 0.05 % sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C,-20 °C

Stockage commentaire: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Détails sur VEGFA

Antigène: VEGFA (Vascular Endothelial Growth Factor A (VEGFA))

Autre désignation: VEGFA / VEGF

Sujet: Name/Gene ID: VEGFA
Family: PDGF

Synonyms: VEGFA, VPF, Vascular permeability factor, VEGF, VEGF-A, MVCD1

ID gène: 7422

UniProt: P15692

Pathways: Signalisation RTK, Glycosaminoglycan Metabolic Process, Regulation of Cell Size, Tube Formation, Signaling Events mediated by VEGFR1 and VEGFR2, Platelet-derived growth Factor Receptor Signaling, VEGFR1 Specific Signals, VEGF Signaling