AIF anticorps (AA 582-613)
-
- Antigène Voir toutes AIF (AIFM1) Anticorps
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
-
Épitope
- AA 582-613
-
Reactivité
- Humain, Souris, Rat, Porc, Boeuf (Vache), Cheval, Lapin, Singe, Hamster, Roussette (Chauve-souris), Gibbon
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AIF est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Specificité
- Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers. .
- Purification
- Immunogen affinity purified
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product AIFM1 Anticorps primaire
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
-
Target Species of Antibody: Human
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Distilled water
- Concentration
- Lot specific
- Buffer
- Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- avoid freeze thaw cycles
- Stock
- 4 °C,-20 °C
- Stockage commentaire
- At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.
-
- Antigène
- AIF (AIFM1) (Apoptosis-Inducing Factor, Mitochondrion-Associated, 1 (AIFM1))
- Autre désignation
- AIFM1 / AIF / PDCD8 (AIFM1 Produits)
- Synonymes
- anticorps AIF, anticorps CMTX4, anticorps COWCK, anticorps COXPD6, anticorps PDCD8, anticorps CG7263, anticorps DmAIF, anticorps Dmel\\CG7263, anticorps GB16024, anticorps DDBDRAFT_0187853, anticorps DDBDRAFT_0191137, anticorps DDB_0187853, anticorps DDB_0191137, anticorps aif, anticorps pdcd8, anticorps AIFM1, anticorps PCD8, anticorps AIFsh2, anticorps Hq, anticorps Pdcd8, anticorps mAIF, anticorps Aif, anticorps zgc:91994, anticorps apoptosis inducing factor mitochondria associated 1, anticorps allograft inflammatory factor 1, anticorps Apoptosis inducing factor, anticorps apoptosis-inducing factor 1, mitochondrial, anticorps apoptosis inducing factor, anticorps apoptosis inducing factor, mitochondria associated 1, anticorps apoptosis-inducing factor, mitochondrion-associated, 1, anticorps apoptosis-inducing factor, mitochondrion-associated 1, anticorps AIFM1, anticorps AIF1, anticorps AIF, anticorps LOC412212, anticorps aif, anticorps aifm1, anticorps Aifm1
- Sujet
-
Name/Gene ID: AIFM1
Family: Apoptosis
Synonyms: AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8 - ID gène
- 9131
- Pathways
- Apoptose, Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis, Smooth Muscle Cell Migration, L'effet Warburg
-