Caspase 2 anticorps (AA 378-409)

N° du produit ABIN2738755

Détail du produit anti-Caspase 2 anticorps

Antigène: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Épitope: AA 378-409

Reactivité: Humain, Souris, Rat, Singe, Cobaye, Orang-Utan, Chimpanzé, Gibbon

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Caspase 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle.

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CASP2(378-409aa RNTKRGSWYIEALAQVFSERACDMHVADMLVK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur Caspase 2

Antigène: Caspase 2 (CASP2) (Caspase 2, Apoptosis-Related Cysteine Peptidase (CASP2))

Autre désignation: CASP2 / Caspase 2 (CASP2 Produits)

Synonymes: anticorps xCaspase-2, anticorps Caspase-2, anticorps ICH-1, anticorps Nedd2, anticorps CASP-2, anticorps ICH1, anticorps NEDD-2, anticorps NEDD2, anticorps PPP1R57, anticorps ICH-1L/1S, anticorps ICH1L1S, anticorps caspase 2, anticorps caspase 2 L homeolog, anticorps caspase-2, anticorps CASP2, anticorps casp2.L, anticorps CpipJ_CPIJ008254, anticorps Casp2

Sujet: Name/Gene ID: CASP2
Subfamily: Cysteine C14
Family: Protease

Synonyms: CASP2, CASP-2, Caspase-2, PPP1R57, Protease ICH-1, NEDD-2, Caspase 2, ICH1, NEDD2

ID gène: 835

Pathways: Apoptose, Caspase Cascade in Apoptosis, Neurotrophin Signaling Pathway