Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Leptin anticorps (Middle Region)

LEP Reactivité: Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
N° du produit ABIN3043294
  • Antigène Voir toutes Leptin (LEP) Anticorps
    Leptin (LEP)
    Épitope
    • 25
    • 16
    • 15
    • 15
    • 12
    • 11
    • 7
    • 5
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    AA 74-109, Middle Region
    Reactivité
    • 118
    • 71
    • 71
    • 12
    • 8
    • 7
    • 5
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    Souris
    Hôte
    • 167
    • 24
    • 7
    • 5
    • 1
    Lapin
    Clonalité
    • 178
    • 25
    Polyclonal
    Conjugué
    • 99
    • 25
    • 16
    • 8
    • 8
    • 7
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 1
    Cet anticorp Leptin est non-conjugé
    Application
    • 125
    • 77
    • 66
    • 39
    • 39
    • 38
    • 32
    • 30
    • 22
    • 18
    • 16
    • 11
    • 11
    • 6
    • 5
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB), ELISA
    Fonction
    Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
    Séquence
    KMDQTLAVYQ QVLTSLPSQN VLQIANDLEN LRDLLH
    Réactivité croisée (Details)
    No cross reactivity with other proteins.
    Attributs du produit
    Rabbit IgG polyclonal antibody for Leptin(LEP) detection. Tested with WB, ELISA in Mouse.
    Gene Name: leptin
    Protein Name: Leptin
    Purification
    Immunogen affinity purified.
    Immunogène
    A synthetic peptide corresponding to a sequence in the middle region of mouse Leptin (74-109aa KMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLH), different from the related human sequence by five amino acids, and from the related rat sequence by two amino acids.
    Isotype
    IgG
    Top Product
    Discover our top product LEP Anticorps primaire
  • Indications d'application
    WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
    ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

    Notes: Tested Species: Species with positive results.
    Other applications have not been tested. Optimal dilutions should be determined by end users.
    Commentaires

    Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
    Concentration
    500 μg/mL
    Buffer
    Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
    Agent conservateur
    Sodium azide
    Précaution d'utilisation
    This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
    Conseil sur la manipulation
    Avoid repeated freezing and thawing.
    Stock
    4 °C/-20 °C
    Stockage commentaire
    At -20°C for one year. After reconstitution, at 4°C for one month.
    It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
  • Li, Zhao, Qi, Wang, Zhang, Li, Qin: "lncRNA Ftx promotes aerobic glycolysis and tumor progression through the PPARγ pathway in hepatocellular carcinoma." dans: International journal of oncology, Vol. 53, Issue 2, pp. 551-566, (2018) (PubMed).

    Qin, Ma, Yang, Hu, Zhou, Fu, Tian, Liu, Xu, Shen: "A Triterpenoid Inhibited Hormone-Induced Adipocyte Differentiation and Alleviated Dexamethasone-Induced Insulin Resistance in 3T3-L1 adipocytes." dans: Natural products and bioprospecting, Vol. 5, Issue 3, pp. 159-66, (2015) (PubMed).

    Yuan, Zhang, Cai, Ding, Wang, Chen, Wang, Yan, Lu: "Leptin induces cell proliferation and reduces cell apoptosis by activating c-myc in cervical cancer." dans: Oncology reports, Vol. 29, Issue 6, pp. 2291-6, (2013) (PubMed).

    Cheng, Dai, Dai: "Testis dysfunction by isoproterenol is mediated by upregulating endothelin receptor A, leptin and protein kinase Cvarepsilon and is attenuated by an endothelin receptor antagonist CPU0213." dans: Reproductive toxicology (Elmsford, N.Y.), Vol. 29, Issue 4, pp. 421-6, (2010) (PubMed).

  • Antigène
    Leptin (LEP)
    Autre désignation
    LEP (LEP Produits)
    Synonymes
    anticorps ob, anticorps obese, anticorps LEPD, anticorps OB, anticorps OBS, anticorps leptin, anticorps Lep, anticorps LEP, anticorps lep
    Sujet
    Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the synthesis of Leptin have been found to be obese and diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse, and rat cells. The expression of Leptin mRNA has been shown to be restricted to adipose tissue. Although regulation of fat stores is deemed to be the primary function of leptin, it also plays a role in other physiological processes, as evidenced by its multiple sites of synthesis other than fat cells, and the multiple cell types beside hypothalamic cells that have leptin receptors. Many of these additional functions are yet to be defined.

    Synonyms: FLJ94114 antibody|LEP antibody|LEP_HUMAN antibody|LEPD antibody|Leptin (murine obesity homolog) antibody|Leptin (obesity homolog, mouse) antibody|Leptin antibody|Leptin Murine Obesity Homolog antibody|Leptin Precursor Obesity Factor antibody|OB antibody|Obese Protein antibody|Obese, mouse, homolog of antibody|Obesity antibody|Obesity factor antibody|Obesity factor antibody|Obesity homolog mouse antibody|Obesity Murine Homolog Leptin antibody|OBS antibody|OTTHUMP00000212285 antibody
    ID gène
    16846
    UniProt
    P41160
    Pathways
    Signalistation JAK/STAT, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
Vous êtes ici:
Support technique