MMP12 anticorps (C-Term)

N° du produit ABIN3043407

Détail du produit anti-MMP12 anticorps

Antigène: MMP12 (Matrix Metallopeptidase 12 (Macrophage Elastase) (MMP12))

Épitope: AA 432-466, C-Term

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP12 est non-conjugé

Application: Western Blotting (WB), ELISA

Fonction: Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.

Séquence: KIDAVLYFKR HYYIFQGAYQ LEYDPLFRRV TKTLK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.
Gene Name: matrix metallopeptidase 12 (macrophage elastase)
Protein Name: Macrophage metalloelastase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse

Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MMP12

Antigène: MMP12 (Matrix Metallopeptidase 12 (Macrophage Elastase) (MMP12))

Autre désignation: MMP12 (MMP12 Produits)

Synonymes: anticorps MMP12, anticorps AV378681, anticorps Mmel, anticorps Mme, anticorps HME, anticorps ME, anticorps MME, anticorps MMP-12, anticorps matrix metallopeptidase 12, anticorps MMP12, anticorps Mmp12

Sujet: Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.

Synonyms: EC 3.4.24.65 antibody|HME antibody|Macrophage elastase antibody|Macrophage metalloelastase antibody|Macrophage metaloelastase antibody|Matrix metallopeptidase 12 (macrophage elastase) antibody|Matrix metalloprotease 12 antibody|Matrix metalloproteinase-12 antibody|ME antibody|MGC138506 antibody|MME antibody|MMP 12 antibody|MMP-12 antibody|Mmp12 antibody|MMP12_HUMAN antibody

ID gène: 17381

UniProt: P34960