RRM2 anticorps (N-Term)

N° du produit ABIN3043425

Détail du produit anti-RRM2 anticorps

Antigène: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Épitope: AA 1-33, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRM2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: MLSLRVPLAP ITDPQQLQLS PLKGLSLVDK ENT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ribonucleoside-diphosphate reductase subunit M2(RRM2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ribonucleotide reductase M2
Protein Name: Ribonucleoside-diphosphate reductase subunit M2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT), different from the related mouse and rat sequences by eight amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-RRM2 (ABIN3043425)

Xu, Li, Tao, Li, Fang, Zhao, Li, Li, Wang, Feng, Pan: "Histone acetyltransferase inhibitor II induces apoptosis in glioma cell lines via the p53 signaling pathway." dans: Journal of experimental & clinical cancer research : CR, Vol. 33, pp. 108, (2015) (PubMed).

Détails sur RRM2

Antigène: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Autre désignation: RRM2 (RRM2 Produits)

Synonymes: anticorps R2, anticorps RR2, anticorps RR2M, anticorps AA407299, anticorps rrm2, anticorps rr2m, anticorps cb111, anticorps chunp6884, anticorps r2, anticorps ribonucleotide reductase regulatory subunit M2, anticorps ribonucleotide reductase M2, anticorps ribonucleotide reductase M2, gene 2 L homeolog, anticorps ribonucleotide reductase M2, gene 1, anticorps ribonucleotide reductase M2 polypeptide, anticorps RRM2, anticorps Rrm2, anticorps rrm2.2.L, anticorps rrm2.1, anticorps rrm2

Sujet: Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.

Synonyms: R2 antibody|Ribonucleoside-diphosphate reductase subunit M2 antibody|Ribonucleotide reductase M2 antibody|Ribonucleotide reductase M2 polypeptide antibody|Ribonucleotide reductase M2 subunit antibody|Ribonucleotide reductase small chain antibody|Ribonucleotide reductase small subunit antibody|RIR2_HUMAN antibody|RR2 antibody|RR2M antibody|RRM2 antibody

ID gène: 6241

UniProt: P31350

Pathways: Mitotic G1-G1/S Phases