PKLR anticorps (C-Term)

N° du produit ABIN3043607

Détail du produit anti-PKLR anticorps

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Épitope: AA 522-552, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKLR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EAIWADDVDR RVQFGIESGK LRGFLRVGDL V

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Pyruvate kinase PKLR(PKLR) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: pyruvate kinase, liver and RBC
Protein Name: Pyruvate kinase PKLR

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human PKLR (522-552aa EAIWADDVDRRVQFGIESGKLRGFLRVGDLV), different from the related mouse sequence by one amino acid, and identical to the rat sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PKLR

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Autre désignation: PKLR (PKLR Produits)

Synonymes: anticorps PK1, anticorps PKL, anticorps PKR, anticorps PKRL, anticorps RPK, anticorps Pklg, anticorps wu:fd15e01, anticorps wu:fi37e08, anticorps pk1, anticorps PKLR, anticorps Pk-1, anticorps Pk1, anticorps R-PK, anticorps pklr, anticorps pyruvate kinase L/R, anticorps pyruvate kinase, liver and RBC, anticorps pyruvate kinase, liver and RBC L homeolog, anticorps pyruvate kinase liver and red blood cell, anticorps pyruvate kinase PKLR-like, anticorps PKLR, anticorps Pklr, anticorps pklr, anticorps pklr.L, anticorps LOC100621940

Sujet: Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene.

Synonyms: EC 2.7.1.40 antibody|KPYR_HUMAN antibody|L-PK antibody|Pk-1 antibody|PK1 antibody|PKL antibody|Pklg antibody|Pklr antibody|PKR antibody|PKRL antibody|Pyruvate kinase 1 antibody|Pyruvate kinase isozymes R/L antibody|Pyruvate kinase liver and blood cell antibody|Pyruvate kinase liver and RBC antibody|Pyruvate kinase liver and red blood cell antibody|Pyruvate kinase liver type antibody|Pyruvate kinase type L antibody|Pyruvate kinase, red cell type antibody|R type/L type pyruvate kinase antibody|R-PK antibody|R-type/L-type pyruvate kinase antibody|Red cell/liver pyruvate kinase antibody|RPK antibody

ID gène: 5313

UniProt: P30613

Pathways: Ribonucleoside Biosynthetic Process