Aspartate beta Hydroxylase anticorps (C-Term)

N° du produit ABIN3043790

Détail du produit anti-Aspartate beta Hydroxylase anticorps

Antigène: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Épitope: AA 726-758, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aspartate beta Hydroxylase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: EVWQDASSFR LIFIVDVWHP ELTPQQRRSL PAI

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Aspartyl/asparaginyl beta-hydroxylase(ASPH) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aspartate beta-hydroxylase
Protein Name: Aspartyl/asparaginyl beta-hydroxylase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Aspartate beta Hydroxylase

Antigène: Aspartate beta Hydroxylase (ASPH) (Aspartate beta-Hydroxylase (ASPH))

Autre désignation: ASPH (ASPH Produits)

Synonymes: anticorps AAH, anticorps BAH, anticorps CASQ2BP1, anticorps HAAH, anticorps JCTN, anticorps junctin, anticorps 2310005F16Rik, anticorps 3110001L23Rik, anticorps AI848629, anticorps AW261690, anticorps AW561901, anticorps C79816, anticorps cI-37, anticorps aah, anticorps bah, anticorps jctn, anticorps MGC107896, anticorps cb971, anticorps fb69e10, anticorps fc06d04, anticorps fc95a08, anticorps wu:fb69e10, anticorps wu:fc06d04, anticorps wu:fc95a08, anticorps aspartate beta-hydroxylase, anticorps aspartate-beta-hydroxylase, anticorps aspartate beta-hydroxylase L homeolog, anticorps ASPH, anticorps Asph, anticorps asph, anticorps asph.L

Sujet: ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.

Synonyms: A beta H J J antibody|AAH antibody|ASP beta hydroxylase antibody|Aspartyl/asparaginyl beta hydroxylase antibody|ASPH antibody|ASPH_HUMAN antibody|BAH antibody|Cardiac junctin antibody|CASQ2BP1 antibody|HAAH antibody|Humbug antibody|JCTN antibody|junctin antibody| Peptide aspartate beta dioxygenase antibody

ID gène: 444

UniProt: Q12797

Pathways: Positive Regulation of Endopeptidase Activity